Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0230600_circ_g.2 |
| ID in PlantcircBase | osa_circ_027093 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 7929376-7929669 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0230600 |
| Parent gene annotation |
DUF1620-containing and WD40-like repeat protein, Scaffold protei n for assembly of the restoration of fertility complex (Os05t023 0600-01);Similar to predicted protein. (Os05t0230600-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0230600_circ_g.3 Os05g0230600_circ_g.4 Os05g0230600_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0230600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.214636423 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7929669-7929398(+) 7929466-7929480(+) 7929381-7929423(-) |
| Potential amino acid sequence |
MHQKYIGKVKQAVYHSQKSGRRRVVVLTEENVIASLDLRSGDIFWRHVIEKNDPVDELSLSLGK CIRSTSAK*(+) MLLLLLIFVQEIYFGGTSLRRMILWMSLVYHLENASEVHRQSKAGSLPQSEKWKETCCGVDRGK CYCFS*(+) MHFPSDKLSSSTGSFFSMTCLQNISPERRSREAITFSSVNTTTRLLPLF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |