Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0549000_circ_g.4 |
| ID in PlantcircBase | osa_circ_028790 |
| Alias | Os05circ17102 |
| Organism | Oryza sativa |
| Position | chr5: 27239822-27240075 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
| Parent gene | Os05g0549000 |
| Parent gene annotation |
Epsin-like, N-terminal domain containing protein. (Os05t0549000- 01);Epsin-like, N-terminal domain containing protein. (Os05t0549 000-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0549000_circ_g.2 Os05g0549000_circ_g.3 |
| Support reads | 2/3 |
| Tissues | leaf/root, anther |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0549000-02:2 Os05t0549000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.237861614 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27240056-27239860(+) 27240068-27239824(-) |
| Potential amino acid sequence |
MSWHLKKLPQSGKLEIPSKF*(+) MPRHEALKALEIYRRAGQQAGSLSDFYENCRGLELARNFQFPTLREFFEMPRHEALKALEIYRR AGQQAGSLSDFYENCRGLELARNFQFPTLREFFEMPRHEALKALEIYRRAGQQAGSLSDFYENC RGLELARNFQFPTLREFFEMPRHEALKALEIYRRAGQQAGSLSDFYENCRGLELARNFQFPTLR E(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |