Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G26220_circ_g.1 |
ID in PlantcircBase | ath_circ_032895 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 13284307-13284531 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT4G26220 |
Parent gene annotation |
Probable caffeoyl-CoA O-methyltransferase At4g26220 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 4 |
Tissues | root, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G26220.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.548615367 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13284394-13284528(+) |
Potential amino acid sequence |
MATAPDAGQLMGMLLNLVNARKTIEVGVFTGYSLLLTALTLPEDGKYILETSVYPREPEVLREL RNITHNHPQAGMATAPDAGQLMGMLLNLVNARKTIEVGVFTGYSLLLTALTLPEDGKYILETSV YPREPEVLRELRNITHNHPQAGMATAPDAGQLMGMLLNLVNARKTIEVGVFTGYSLLLTALTLP EDGKYILETSVYPREPEVLRELRNITHNHPQAGMATAPDAGQLMGMLLNLVNARKTIEVGVFTG YSLLLTALTLPEDGK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |