Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0405000_circ_g.4 |
| ID in PlantcircBase | osa_circ_027836 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 19719723-19719851 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os05g0405000 |
| Parent gene annotation |
Orthophosphate dikinase precursor (EC 2.7.9.1). (Os05t0405000-01 );Similar to Isoform 2 of Pyruvate, phosphate dikinase 1, chloro plastic. (Os05t0405000-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0405000_circ_g.2 Os05g0405000_circ_g.3 |
| Support reads | 157 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0405000-02:1 Os05t0405000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.154391667 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19719796-19719725(-) 19719729-19719760(-) |
| Potential amino acid sequence |
MGKTIGYKVGTMIEIPRAALVADEELGHQVDVIRQIANKVFTDMGKTIGYKVGTMIEIPRAALV ADEELGHQVDVIRQIANKVFTDMGKTIGYKVGTMIEIPRAALVADEELGHQVDVIRQIANKVFT DMGKTIGYKVGTMIEIPRAALVADE(-) MRNWGIKWMLSVKLPTRCSQTWEKLLATKLEL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |