Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G26110_circ_g.1 |
| ID in PlantcircBase | ath_circ_004364 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 9025138-9025311 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G26110 |
| Parent gene annotation |
Protein decapping 5 |
| Parent gene strand | - |
| Alternative splicing | AT1G26110_circ_g.2 AT1G26110_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G26110.2:1 AT1G26110.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.441186461 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9025297-9025140(-) |
| Potential amino acid sequence |
MKFTEDFDFTAMNEKFNKDEVWGHLGKSTTLDGDEDDDSPTVDEAELPKIEAKRSHQVMKFTED FDFTAMNEKFNKDEVWGHLGKSTTLDGDEDDDSPTVDEAELPKIEAKRSHQVMKFTEDFDFTAM NEKFNKDEVWGHLGKSTTLDGDEDDDSPTVDEAELPKIEAKRSHQVMKFTEDFDFTAMNEKFNK DEVWGHLGKSTTLDGDEDDDSPTVDEAELPKIEAK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |