Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G292500_circ_g.1 |
| ID in PlantcircBase | gra_circ_000418 |
| Alias | Chr04:62044690|62045154 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 62044690-62045154 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G292500 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.004G292500.1:3 Gorai.004G292500.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | csi_circ_001100 |
| PMCS | 0.277418082 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
62045043-62045152(-) 62045048-62045121(-) 62045121-62044834(+) |
| Potential amino acid sequence |
MPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYS*(- ) MTCQILLIHTCTGLVELADLAPRVLQLHLFRLLQILMCSIRSRRGLRWILRNFQSRLIHLHTVD SLQRFQGGS*(-) MTLLETFVTSQLYVDVSICSGSSLISTSNLSWT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |