Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G80410_circ_g.10 |
ID in PlantcircBase | ath_circ_011289 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 30229918-30230148 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | AT1G80410 |
Parent gene annotation |
Tetratricopeptide repeat (TPR)-containing protein |
Parent gene strand | - |
Alternative splicing | AT1G80410_circ_g.1 AT1G80410_circ_g.2 AT1G80410_circ_g.3 AT1G80410_circ_g.4 AT1G80410_circ_g.5 AT1G80410_circ_g.6 AT1G80410_circ_g.7 AT1G80410_circ_g.8 AT1G80410_circ_g.9 AT1G80410_circ_g.11 AT1G80410_circ_g.12 AT1G80410_circ_g.13 AT1G80410_circ_g.14 |
Support reads | 31 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G80410.2:1 AT1G80410.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.439500324 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30230010-30229920(-) |
Potential amino acid sequence |
MTLRSYVDMLKFQDRLHSFPYFHKAAIRAIRYDLASGDSYFRQGDLGRALKKFLAVEKHYADIS EDQFDFHSYCLRKMTLRSYVDMLKFQDRLHSFPYFHKAAIRAIRYDLASGDSYFRQGDLGRALK KFLAVEKHYADISEDQFDFHSYCLRKMTLRSYVDMLKFQDRLHSFPYFHKAAIRAIRYDLASGD SYFRQGDLGRALKKFLAVEKHYADISEDQFDFHSYCLRKMTLRSYVDMLKFQDRLHSFPYFHKA AIRAI(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |