Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0208200_circ_g.4 |
ID in PlantcircBase | osa_circ_013753 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 6065686-6066130 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0208200 |
Parent gene annotation |
Similar to RNA-binding protein 25. (Os02t0208200-01) |
Parent gene strand | + |
Alternative splicing | Os02g0208200_circ_g.1 Os02g0208200_circ_g.2 Os02g0208200_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0208200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.146335243 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6066111-6066127(+) |
Potential amino acid sequence |
MSEKELQVSQIKDKVAAKEQHIADLQKRSQKLEDELSAARKVSSERQLVVTKLYKCFLQLQDYN DRVKMSEKELQVSQIKDKVAAKEQHIADLQKRSQKLEDELSAARKVSSERQLVVTKLYKCFLQL QDYNDRVKMSEKELQVSQIKDKVAAKEQHIADLQKRSQKLEDELSAARKVSSERQLVVTKLYKC FLQLQDYNDRVKMSEKELQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |