Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc12g042060.1_circ_g.2 |
ID in PlantcircBase | sly_circ_003623 |
Alias | Slcirc180 |
Organism | Solanum lycopersicum |
Position | chr12: 40792202-40792817 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc12g042060.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | - |
Alternative splicing | Solyc12g042060.1_circ_g.1 |
Support reads | 63 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Solyc12g042060.1.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.895265101 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
40792814-40792334(+) 40792573-40792579(-) |
Potential amino acid sequence |
MPFFPSIVSGTSPFAILCAKPSAIAVLPTPGSPIRQGLFLVRRPKI*(+) MVGESNEAVGASVGGGTSGQKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGRRTKN NPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKGITILVRSTCYLDCYVKVKVWLPVFLKT WVLTPATSALR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Wang et al., 2018b |