Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0308000_circ_g.6 |
| ID in PlantcircBase | osa_circ_019474 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 10964780-10964943 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0308000 |
| Parent gene annotation |
Ubiquitin-conjugating enzyme/RWD-like domain containing protein. (Os03t0308000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0308000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.316209451 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10964940-10964864(+) 10964813-10964794(+) 10964815-10964884(-) 10964811-10964889(-) |
| Potential amino acid sequence |
MSAHSSCSFDCIHANTRWWGIGFVGLQKGR*(+) MPTPGGGALGSLDFKKEDRRALAIKSRETPPKFGSAERQKVIDECAQLL*(+) MNAIKATRAVRTHQLLFGVLQSQTLVVFHVI*(-) MQSKLQELCALINYFLAFCRAKLWWCFT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |