Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G26000_circ_g.16 |
ID in PlantcircBase | ath_circ_040476 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 9081654-9081895 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT5G26000 |
Parent gene annotation |
TGG1 |
Parent gene strand | - |
Alternative splicing | AT5G26000_circ_g.15 AT5G26000_circ_g.17 AT5G26000_circ_g.18 AT5G26000_circ_g.19 AT5G26000_circ_g.20 AT5G26000_circ_g.21 |
Support reads | 3 |
Tissues | inflorescences, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G26000.2:2 AT5G26000.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.304145871 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9081715-9081656(-) |
Potential amino acid sequence |
MDELNSTGYRFSIAWSRLLPKKGGADLGNGDTTCDSYTLWQKDIDVMDELNSTGYRFSIAWSRL LPKKGGADLGNGDTTCDSYTLWQKDIDVMDELNSTGYRFSIAWSRLLPKKGGADLGNGDTTCDS YTLWQKDIDVMDELNSTGYRFSIAWSRLLP(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |