Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0691600_circ_g.4 |
| ID in PlantcircBase | osa_circ_003433 |
| Alias | Os_ciR1843 |
| Organism | Oryza sativa |
| Position | chr1: 28547584-28547947 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os01g0691600 |
| Parent gene annotation |
Similar to DNA repair helicase XPB2 (EC 3.6.1.-) (XPB homolog 2) (ERCC3 homolog 2) (RAD25 homolog 2) (AtXPB2). (Os01t0691600-01) ;Similar to XPB1 (ARABIDOPSIS HOMOLOG OF XERODERMA PIGMENTOSUM C OMPLEMENTATION GROUP B 1); ATP-dependent helicase. (Os01t0691600 -02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0691600_circ_g.5 Os01g0691600_circ_g.6 |
| Support reads | 6/3 |
| Tissues | root/shoot, root, seed, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0691600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010581 |
| PMCS | 0.34231337 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28547595-28547649(+) 28547914-28547649(+) 28547678-28547734(-) |
| Potential amino acid sequence |
MHEYNLTPHSLYAAVSVGLETSTIISVMSKLSKTKLPREIIDFIHASTANYGKVKLVLKKNRYF VESPFPEVLKTLLKDDIICRARISPEARIHARVQSNTPLTICCGLSWA*(+) MISFAEHGYLLRPESMHEYNLTPHSLYAAVSVGLETSTIISVMSKLSKTKLPREIIDFIHASTA NYGKVKLVLKKNRYFVESPFPEVLKTLLKDDIICRARISPEARIHARVQSNTPLTICCGLSWA* (+) MTLIIVLVSSPTETAAYSEWGVRLYSCMDSGLRRYPCSANDIIFQKRLQNLREWRLHKISILLQ NKLHFTIIGS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |