Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0691600_circ_g.4 |
ID in PlantcircBase | osa_circ_003433 |
Alias | Os_ciR1843 |
Organism | Oryza sativa |
Position | chr1: 28547584-28547947 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os01g0691600 |
Parent gene annotation |
Similar to DNA repair helicase XPB2 (EC 3.6.1.-) (XPB homolog 2) (ERCC3 homolog 2) (RAD25 homolog 2) (AtXPB2). (Os01t0691600-01) ;Similar to XPB1 (ARABIDOPSIS HOMOLOG OF XERODERMA PIGMENTOSUM C OMPLEMENTATION GROUP B 1); ATP-dependent helicase. (Os01t0691600 -02) |
Parent gene strand | + |
Alternative splicing | Os01g0691600_circ_g.5 Os01g0691600_circ_g.6 |
Support reads | 6/3 |
Tissues | root/shoot, root, seed, pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0691600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010581 |
PMCS | 0.34231337 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28547595-28547649(+) 28547914-28547649(+) 28547678-28547734(-) |
Potential amino acid sequence |
MHEYNLTPHSLYAAVSVGLETSTIISVMSKLSKTKLPREIIDFIHASTANYGKVKLVLKKNRYF VESPFPEVLKTLLKDDIICRARISPEARIHARVQSNTPLTICCGLSWA*(+) MISFAEHGYLLRPESMHEYNLTPHSLYAAVSVGLETSTIISVMSKLSKTKLPREIIDFIHASTA NYGKVKLVLKKNRYFVESPFPEVLKTLLKDDIICRARISPEARIHARVQSNTPLTICCGLSWA* (+) MTLIIVLVSSPTETAAYSEWGVRLYSCMDSGLRRYPCSANDIIFQKRLQNLREWRLHKISILLQ NKLHFTIIGS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |