Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0254100_circ_g.15 |
| ID in PlantcircBase | osa_circ_001148 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 8427029-8427411 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0254100 |
| Parent gene annotation |
Similar to CTV.2. (Os01t0254100-01);Similar to Lissencephaly typ e-1-like homology motif; CTLH, C-terminal to LisH motif; Nitrous oxide reductase, N-terminal; WD40-like; Quinonprotein alcohol d ehydrogenase-like. (Os01t0254100-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0254100-01:2 Os01t0254100-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.492165441 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8427340-8427030(+) 8427112-8427409(-) 8427105-8427387(-) |
| Potential amino acid sequence |
MISEQSLDIWIWPRILTKLMLPVQA*(+) MANAAAATSSVPSAVVAASSLPVPPNQA*(-) MLLLLHHLFHLLLWRHHHYLFRQIKLELAASAL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |