Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G40840_circ_g.11 |
| ID in PlantcircBase | ath_circ_017697 |
| Alias | At_ciR4239 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 17047579-17047922 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT2G40840 |
| Parent gene annotation |
4-alpha-glucanotransferase DPE2 |
| Parent gene strand | + |
| Alternative splicing | AT2G40840_circ_g.2 AT2G40840_circ_g.3 AT2G40840_circ_g.4 AT2G40840_circ_g.5 AT2G40840_circ_g.6 AT2G40840_circ_g.7 AT2G40840_circ_g.8 AT2G40840_circ_g.9 AT2G40840_circ_g.10 AT2G40840_circ_g.12 AT2G40840_circ_g.13 AT2G40840_circ_g.14 AT2G40840_circ_g.15 |
| Support reads | 4 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G40840.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.211983624 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17047600-17047919(+) |
| Potential amino acid sequence |
METKLSIAKKIFDIEKDQTLNSSTFQKFFSENEGWLKPYAAFCFLRDFFETSDHSQWGTFSDYT DDKDVDYEATMETKLSIAKKIFDIEKDQTLNSSTFQKFFSENEGWLKPYAAFCFLRDFFETSDH SQWGTFSDYTDDKDVDYEATMETKLSIAKKIFDIEKDQTLNSSTFQKFFSENEGWLKPYAAFCF LRDFFETSDHSQWGTFSDYTDDKDVDYEATMETKLSIAKKIFDIEKDQTLNSSTFQKFFSENEG WLKPYAAFCFLRDFFETSDHSQWGTFSDYTDDK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |