Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G21600_circ_g.1 |
ID in PlantcircBase | ath_circ_003782 |
Alias | At_ciR515 |
Organism | Arabidpsis thaliana |
Position | chr1: 7572122-7572580 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT1G21600 |
Parent gene annotation |
AT1G21600 protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 8 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G21600.1:2 AT1G21600.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.210172432 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7572566-7572124(-) |
Potential amino acid sequence |
MSDYGCYNVTEPPIDAPRDPLYKSEREISKVFLTKHYRNRRTNDPEFVLDLEEIYVIDSKTKSI TRARVLYIRCAMSDYGCYNVTEPPIDAPRDPLYKSEREISKVFLTKHYRNRRTNDPEFVLDLEE IYVIDSKTKSITRARVLYIRCAMSDYGCYNVTEPPIDAPRDPLYKSEREISKVFLTKHYRNRRT NDPEFVLDLEEIYVIDSKTKSITRARVLYIRCAMSDYGCYNVTEPPIDAPRDPLYKSEREISKV FLTKHYRNRRTNDPEFVLDLEEIYVIDSKTKSITRARVL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |