Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G21600_circ_g.1 |
| ID in PlantcircBase | ath_circ_003782 |
| Alias | At_ciR515 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 7572122-7572580 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT1G21600 |
| Parent gene annotation |
AT1G21600 protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 8 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G21600.1:2 AT1G21600.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.210172432 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7572566-7572124(-) |
| Potential amino acid sequence |
MSDYGCYNVTEPPIDAPRDPLYKSEREISKVFLTKHYRNRRTNDPEFVLDLEEIYVIDSKTKSI TRARVLYIRCAMSDYGCYNVTEPPIDAPRDPLYKSEREISKVFLTKHYRNRRTNDPEFVLDLEE IYVIDSKTKSITRARVLYIRCAMSDYGCYNVTEPPIDAPRDPLYKSEREISKVFLTKHYRNRRT NDPEFVLDLEEIYVIDSKTKSITRARVLYIRCAMSDYGCYNVTEPPIDAPRDPLYKSEREISKV FLTKHYRNRRTNDPEFVLDLEEIYVIDSKTKSITRARVL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |