Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G28715_circ_g.2 |
| ID in PlantcircBase | ath_circ_004735 |
| Alias | AtciR129, AtciR129 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 10097934-10100152 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT1G28715 |
| Parent gene annotation |
lncRNA |
| Parent gene strand | - |
| Alternative splicing | AT1G28715_circ_g.1 AT1G28715_circ_g.3 AT1G28715_circ_g.4 AT1G28715_circ_g.5 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G28715.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.297817066 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10098023-10100141(-) |
| Potential amino acid sequence |
MKWQNSASDVLCSIHYPKKCFLAPRRESQDHTL* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |