Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0131800_circ_g.5 |
| ID in PlantcircBase | osa_circ_012984 |
| Alias | Os_ciR4386 |
| Organism | Oryza sativa |
| Position | chr2: 1660458-1661231 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0131800 |
| Parent gene annotation |
Trivalent AI influx transporter, Aluminum (Al) tolerance (Os02t0 131800-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0131800_circ_g.6 |
| Support reads | 5/5 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0131800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.270511466 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1661209-1661215(-) 1660493-1661039(-) |
| Potential amino acid sequence |
MVFALLIQTLAANLGVKTGRHLAELCREEYPHYVNIFLWIIAELAVISDDIPEVLGTAFAFNIL LKIPVWAGVILTVFSTLLLLGVQRFGARKLEFIIAAFMFTMAACFFGELSYLRPSAGEVVKGMF VPSLQGKGAAANAIALFGAIITPFCGSS*(-) MRSHSLALSSHPSVGHLSWDGLCTSDPNISCQPWSENRKAPC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |