Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G27960_circ_g.2 |
ID in PlantcircBase | ath_circ_033251 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 13916302-13916406 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G27960 |
Parent gene annotation |
Ubiquitin conjugating enzyme 9 |
Parent gene strand | - |
Alternative splicing | AT4G27960_circ_g.1 AT4G27960_circ_g.3 AT4G27960_circ_g.4 AT4G27960_circ_g.5 |
Support reads | 4 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G27960.1:1 AT4G27960.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.63026286 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13916380-13916403(+) 13916342-13916403(+) |
Potential amino acid sequence |
MEHLRPKSHLGNCESRTPLLLQDVEADASIAVNVWMEHLRPKSHLGNCESRTPLLLQDVEADAS IAVNVWMEHLRPKSHLGNCESRTPLLLQDVEADASIAVNVWMEHLRPKSH(+) MSRQMLPLLLMFGWNTFVLKATLEIVRAGLHCSFKMSRQMLPLLLMFGWNTFVLKATLEIVRAG LHCSFKMSRQMLPLLLMFGWNTFVLKATLEIVRAGLHCSFKMSRQMLPLLLMFGWNTFVLKA(+ ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |