Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0846900_circ_g.1 |
ID in PlantcircBase | osa_circ_004820 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 36386433-36386650 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0847000 |
Parent gene annotation |
Hypothetical protein. (Os01t0847000-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0846900-01:1 Os01t0846900-01:1 Os01t0847000-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.107415902 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
36386473-36386479(-) |
Potential amino acid sequence |
MPPHQCKGKGKLHVKVSVDPQQPECDAAGIRSTGNKLVINNSVANHQTRPPVTEPSPMPTMGPL SKVPRF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |