Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0633900_circ_g.1 |
ID in PlantcircBase | osa_circ_020725 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 24217219-24218339 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0633900 |
Parent gene annotation |
Nucleic acid-binding, OB-fold-like domain containing protein. (O s03t0633900-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0633900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004977* |
PMCS | 0.120335816 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24218327-24217351(+) 24217363-24218318(-) |
Potential amino acid sequence |
MLESPLFVLLSHQSKGLAKKACHNCSVEREDESTWSLLLPSLEPEVEPT*(+) MEIMLVLPLARVRVKVGTMLTHPPVQLNSCGKPSLLILLTGGITGQIRVTLAFWDDLAVVASEH VKKGDRIFVSGRLVSDTVDEGPEKRQVYYKVVVQQFNFIESFQQVQLYEPEAGLDTLGGKHGDY VGSTSGSSEGKSRDHVDSSSRSTEQLWQAFFANPFDWWDNRTNKGDSSILG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |