Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0218032_circ_g.10 |
ID in PlantcircBase | osa_circ_000846 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 6452101-6452158 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os01g0218032 |
Parent gene annotation |
Putative DNA demethylase, Endosperm development (Os01t0218032-01 ) |
Parent gene strand | + |
Alternative splicing | Os01g0218032_circ_g.3 Os01g0218032_circ_g.4 Os01g0218032_circ_g.5 Os01g0218032_circ_g.6 Os01g0218032_circ_g.7 Os01g0218032_circ_g.8 Os01g0218032_circ_g.9 Os01g0218032_circ_g.11 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0218032-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.287352299 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6452121-6452120(+) 6452149-6452120(+) |
Potential amino acid sequence |
MILAHTYSLYGPQFNQREPDDPCPYLLSIWTPVQPKRTR*(+) MDPSSTKENQMILAHTYSLYGPQFNQREPDDPCPYLLSIWTPVQPKRTR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |