Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0218032_circ_g.10 |
| ID in PlantcircBase | osa_circ_000846 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 6452101-6452158 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0218032 |
| Parent gene annotation |
Putative DNA demethylase, Endosperm development (Os01t0218032-01 ) |
| Parent gene strand | + |
| Alternative splicing | Os01g0218032_circ_g.3 Os01g0218032_circ_g.4 Os01g0218032_circ_g.5 Os01g0218032_circ_g.6 Os01g0218032_circ_g.7 Os01g0218032_circ_g.8 Os01g0218032_circ_g.9 Os01g0218032_circ_g.11 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0218032-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.287352299 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6452121-6452120(+) 6452149-6452120(+) |
| Potential amino acid sequence |
MILAHTYSLYGPQFNQREPDDPCPYLLSIWTPVQPKRTR*(+) MDPSSTKENQMILAHTYSLYGPQFNQREPDDPCPYLLSIWTPVQPKRTR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |