Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0136200_circ_g.2 |
| ID in PlantcircBase | osa_circ_026494 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 2115818-2116118 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0136200 |
| Parent gene annotation |
Serine/threonine protein kinase domain containing protein. (Os05 t0136200-01);Serine/threonine protein kinase domain containing p rotein. (Os05t0136200-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0136200-02:2 Os05t0136200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.314437237 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2116093-2115820(-) 2115869-2115921(-) |
| Potential amino acid sequence |
MVLEFVNGGELFERIAVKGKLSEKEGRRLFQQLIDGVSYCHDRGVYHRDLKVAASKTKIYMVLE FVNGGELFERIAVKGKLSEKEGRRLFQQLIDGVSYCHDRGVYHRDLKVAASKTKIYMVLEFVNG GELFERIAVKGKLSEKEGRRLFQQLIDGVSYCHDRGVYHRDLKVAASKTKIYMVLEFVNGGELF ERIAVKGKLSEKEGRRLFQQLIDGVSYCHDRGVYHRDLK(-) MVLAIAMIGESTTETSRLLLAKLRFTWCLSLSMEVNCLRELQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |