Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0171300_circ_g.1 |
ID in PlantcircBase | osa_circ_018136 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 3817318-3817666 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0171300 |
Parent gene annotation |
Similar to DNA-binding protein-like. (Os03t0171300-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0171300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.14371022 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3817643-3817663(-) 3817324-3817663(-) |
Potential amino acid sequence |
MAKWGCQDSRSSESKILFMPHAPQDMGCGCQMIGEETSQHRDTAESDTHHEV*(-) MRSNLSNRTGMAKWGCQDSRSSESKILFMPHAPQDMGCGCQMIGEETSQHRDTAESDTHHEV*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |