Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0819500_circ_g.3 |
ID in PlantcircBase | osa_circ_017223 |
Alias | Os02circ30343/Os_ciR2545 |
Organism | Oryza sativa |
Position | chr2: 35181953-35182253 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
Parent gene | Os02g0819500 |
Parent gene annotation |
Similar to Cysteine-type peptidase. (Os02t0819500-01);Ovarian tu mour, otubain domain containing protein. (Os02t0819500-03);Simil ar to Cysteine-type peptidase. (Os02t0819500-04) |
Parent gene strand | - |
Alternative splicing | Os02g0819500_circ_g.1 Os02g0819500_circ_g.2 Os02g0819500_circ_g.4 |
Support reads | 3/7/2 |
Tissues | leaf/root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0819500-01:2 Os02t0819500-03:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.380544158 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35182179-35182038(+) 35182189-35182027(+) 35182002-35182211(-) |
Potential amino acid sequence |
MPTDGLYKSYVSAEECKCVSSRCDAWELAPWGKTSFLLLHPLGNCRQCLGMNWN*(+) MGCTNHMSVQKNASASHPDVMHGNWHHGVKPLSYFFIHWETVVSVWA*(+) MDEEVGKRFYPMVPVPMHHIWMRRTCILLH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |