Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0819500_circ_g.3 |
| ID in PlantcircBase | osa_circ_017223 |
| Alias | Os02circ30343/Os_ciR2545 |
| Organism | Oryza sativa |
| Position | chr2: 35181953-35182253 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl, find_circ |
| Parent gene | Os02g0819500 |
| Parent gene annotation |
Similar to Cysteine-type peptidase. (Os02t0819500-01);Ovarian tu mour, otubain domain containing protein. (Os02t0819500-03);Simil ar to Cysteine-type peptidase. (Os02t0819500-04) |
| Parent gene strand | - |
| Alternative splicing | Os02g0819500_circ_g.1 Os02g0819500_circ_g.2 Os02g0819500_circ_g.4 |
| Support reads | 3/7/2 |
| Tissues | leaf/root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0819500-01:2 Os02t0819500-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.380544158 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35182179-35182038(+) 35182189-35182027(+) 35182002-35182211(-) |
| Potential amino acid sequence |
MPTDGLYKSYVSAEECKCVSSRCDAWELAPWGKTSFLLLHPLGNCRQCLGMNWN*(+) MGCTNHMSVQKNASASHPDVMHGNWHHGVKPLSYFFIHWETVVSVWA*(+) MDEEVGKRFYPMVPVPMHHIWMRRTCILLH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |