Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Gh_A02G1314_circ_g.1 |
| ID in PlantcircBase | ghi_circ_000228 |
| Alias | A02:76102000|76102195 |
| Organism | Gossypium hirsutum |
| Position | chrA02: 76102000-76102195 JBrowse» |
| Reference genome | v1.1 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gh_A02G1314 |
| Parent gene annotation |
SIMILAR TO: AT5G09880, Splicing factor, CC1-like |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gh_A02G1314:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
76102118-76102105(-) 76102116-76102029(+) |
| Potential amino acid sequence |
MIGGRIGVGYAAWPLTGKVTACGFGADPLRRGAPREPVMLSCRIKHILQQQTFTGLANRIKCCS RHDWR*(-) MSTTALDSVGQPSECLLLKNMFDPATEHYGLPWSTPP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |