Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0279400_circ_g.1 |
| ID in PlantcircBase | osa_circ_019181 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 9508541-9510170 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0279400 |
| Parent gene annotation |
Similar to predicted protein. (Os03t0279400-01);Similar to Argin ine biosynthesis bifunctional protein argJ 1 [Includes: Glutamat e N-acetyltransferase (EC 2.3.1.35) (Ornithine acetyltransferase ) (Ornithine transacetylase) (OATase); Amino-acid acetyltransfer ase (EC 2.3.1.1) (N-acetylglutamate synthase) (AGS)] [Contains: Arginine biosynthesis bifunctional protein argJ1 alpha chain; Ar ginine biosynthesis bifunctional protein argJ1 beta chain]. (Os0 3t0279400-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0279400-01:9 Os03t0279400-02:9 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.150543553 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9509218-9509988(-) |
| Potential amino acid sequence |
MAKGSGMIHPNMATMLGVLTTDAQVSSDVWREMVRTSVSRSFNQITVDGDTSTNDCVIALASGL SGLSSILTHDSTEAQQFQACLDAELLLRMLLLLHQFCTVSVSLIHQKQLELC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |