Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d052174_circ_g.1 |
ID in PlantcircBase | zma_circ_008172 |
Alias | Zm04circ00077 |
Organism | Zea mays |
Position | chr4: 181716399-181716770 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d052174 |
Parent gene annotation |
Cyclin-dependent kinase inhibitor 1 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d052174_T001:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.049507975 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
181716420-181716756(+) |
Potential amino acid sequence |
MGRLGGREEFLDLLCWRHDQLRSRCCCRRRRRAASLLPPHQIRLQIAELAAVRPARRWRRLSPL AVRDAPRVARGDDIRDVIPVNLEAKRLAWAASAAAKNSWISCAGGTISSAADVVVAGDDEQPVF CRPTRSDSRSLSSPPCARLDDGVVSLLSRSGTLPELLAVTTSGT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |