Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d009919_circ_g.1 |
ID in PlantcircBase | zma_circ_009650 |
Alias | Zm08circ00041, ZmciR366 |
Organism | Zea mays |
Position | chr8: 89489658-89490687 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d009919 |
Parent gene annotation |
DUF21 domain-containing protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d009919_T001:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.207520572 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
89490063-89489690(+) 89489693-89490661(-) |
Potential amino acid sequence |
MPLYDILNEFQKGSSHMAAVVKAKPKTEPPLDKTEPNREAVGPTQLTVPLLSNAEESADNVVVD IERPHNRQINGNTASNAVPRSSEDIEDGEVVGIITLEDVFEELLQEEIVDETDEYVDVHKRIRV AAAAAASSVARAPSVRRLTGQKAAGSNWKNSCPWS*(+) MTTGKNFSNCFLQPFGPLIS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |