Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0401100_circ_g.1 |
| ID in PlantcircBase | osa_circ_006757 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 13559418-13559563 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0401100 |
| Parent gene annotation |
Hypothetical conserved gene. (Os10t0401100-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0401100-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.224567409 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13559470-13559424(+) 13559555-13559435(+) 13559460-13559435(+) |
| Potential amino acid sequence |
MSGSERILNCTEGWALLEILFNFTTQTSYASRKI*(+) MLPEKFENNLNKKTFKIMTYNVWIREDIELHRRLGALGDLIQLHNPDFICFQKNLRII*(+) MTYNVWIREDIELHRRLGALGDLIQLHNPDFICFQKNLRII*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |