Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G14630_circ_g.2 |
ID in PlantcircBase | ath_circ_002556 |
Alias | Ath_circ_FC5553 |
Organism | Arabidpsis thaliana |
Position | chr1: 5020327-5020671 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G14630 |
Parent gene annotation |
unknown protein |
Parent gene strand | + |
Alternative splicing | AT1G14630_circ_g.1 AT1G14630_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G14630.1:2 AT1G14630.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.132850242 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5020380-5020668(+) |
Potential amino acid sequence |
MEIGDVSTGYLEDALIEFSGRSKRRRLSFNGAEDKPDNDLDHSQNHWGLSENYSCTSSQFADAW GLIDESPENIFCSPEMEIGDVSTGYLEDALIEFSGRSKRRRLSFNGAEDKPDNDLDHSQNHWGL SENYSCTSSQFADAWGLIDESPENIFCSPEMEIGDVSTGYLEDALIEFSGRSKRRRLSFNGAED KPDNDLDHSQNHWGLSENYSCTSSQFADAWGLIDESPENIFCSPEMEIGDVSTGYLEDALIEFS GRSKRRRLSFNGAEDKPDNDLDHSQNHWGLSENYSCTSSQFA(+) |
Sponge-miRNAs | ath-miR5663-3p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |