Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G14630_circ_g.2 |
| ID in PlantcircBase | ath_circ_002556 |
| Alias | Ath_circ_FC5553 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 5020327-5020671 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G14630 |
| Parent gene annotation |
unknown protein |
| Parent gene strand | + |
| Alternative splicing | AT1G14630_circ_g.1 AT1G14630_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G14630.1:2 AT1G14630.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.132850242 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5020380-5020668(+) |
| Potential amino acid sequence |
MEIGDVSTGYLEDALIEFSGRSKRRRLSFNGAEDKPDNDLDHSQNHWGLSENYSCTSSQFADAW GLIDESPENIFCSPEMEIGDVSTGYLEDALIEFSGRSKRRRLSFNGAEDKPDNDLDHSQNHWGL SENYSCTSSQFADAWGLIDESPENIFCSPEMEIGDVSTGYLEDALIEFSGRSKRRRLSFNGAED KPDNDLDHSQNHWGLSENYSCTSSQFADAWGLIDESPENIFCSPEMEIGDVSTGYLEDALIEFS GRSKRRRLSFNGAEDKPDNDLDHSQNHWGLSENYSCTSSQFA(+) |
| Sponge-miRNAs | ath-miR5663-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |