Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G64720_circ_g.7 |
| ID in PlantcircBase | ath_circ_008680 |
| Alias | At_ciR3289 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 24047787-24047963 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full |
| Parent gene | AT1G64720 |
| Parent gene annotation |
Polyketide cyclase/dehydrase and lipid transport superfamily pro tein |
| Parent gene strand | - |
| Alternative splicing | AT1G64720_circ_g.3 AT1G64720_circ_g.4 AT1G64720_circ_g.5 AT1G64720_circ_g.6 AT1G64720_circ_g.8 AT1G64720_circ_g.9 |
| Support reads | 2/26 |
| Tissues | leaf/leaf, aerial, inflorescences, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G64720.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.73304696 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24047910-24047789(-) |
| Potential amino acid sequence |
MVRDFFWDDEFRSKWDDMLLYSSTLERCKDTGTMVVQWVRKNGPPQYRSRTVFEDATPEMVRDF FWDDEFRSKWDDMLLYSSTLERCKDTGTMVVQWVRKNGPPQYRSRTVFEDATPEMVRDFFWDDE FRSKWDDMLLYSSTLERCKDTGTMVVQWVRKNGPPQYRSRTVFEDATPEMVRDFFWDDEFRSKW DDMLLYSSTLERCKDTGTMVVQWVRK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |