Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0553300_circ_g.2 |
ID in PlantcircBase | osa_circ_040152 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 21923668-21925118 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0553300 |
Parent gene annotation |
NUDIX hydrolase domain containing protein. (Os09t0553300-01) |
Parent gene strand | - |
Alternative splicing | Os09g0553300_circ_g.1 |
Support reads | 4 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0553300-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.174245486 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21925089-21923867(+) 21923839-21925039(-) |
Potential amino acid sequence |
MGKSVSLTWAPFVYSAVVEFDISGLDIFKIHPQGDNDRRKC*(+) MYLEDVKSGNIKFHYCTINKRCPSQRYAFAHLVEARRNWLFQMEMKR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |