Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0553300_circ_g.2 |
| ID in PlantcircBase | osa_circ_040152 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 21923668-21925118 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0553300 |
| Parent gene annotation |
NUDIX hydrolase domain containing protein. (Os09t0553300-01) |
| Parent gene strand | - |
| Alternative splicing | Os09g0553300_circ_g.1 |
| Support reads | 4 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0553300-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.174245486 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21925089-21923867(+) 21923839-21925039(-) |
| Potential amino acid sequence |
MGKSVSLTWAPFVYSAVVEFDISGLDIFKIHPQGDNDRRKC*(+) MYLEDVKSGNIKFHYCTINKRCPSQRYAFAHLVEARRNWLFQMEMKR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |