Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0626400_circ_g.1 |
ID in PlantcircBase | osa_circ_012422 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 26780971-26781163 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0626400 |
Parent gene annotation |
Similar to Phytoene synthase 1, chloroplast precursor (EC 2.5.1. -) (Fruit ripening specific protein pTOM5). (Os12t0626400-01);Si milar to Phytoene synthase 2 (Fragment). (Os12t0626400-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0626450-00:1 Os12t0626400-01:1 Os12t0626400-02:1 Os12t0626450-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.442709931 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26781136-26781142(+) 26780979-26781110(-) 26781059-26781130(-) |
Potential amino acid sequence |
MEGRFFPSLSGHLLAESRCATPFSASSKNNLARRICPFMNFLHLSVTFPLNMSSSVRPASANSS NGR*(+) MAAQGGEESTFHWMNWQRQV*(-) MKGQILRARLFFDEAEKGVAHLDSASRWPLKEGKNLPSIG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |