Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0626400_circ_g.1 |
| ID in PlantcircBase | osa_circ_012422 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 26780971-26781163 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0626400 |
| Parent gene annotation |
Similar to Phytoene synthase 1, chloroplast precursor (EC 2.5.1. -) (Fruit ripening specific protein pTOM5). (Os12t0626400-01);Si milar to Phytoene synthase 2 (Fragment). (Os12t0626400-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0626450-00:1 Os12t0626400-01:1 Os12t0626400-02:1 Os12t0626450-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.442709931 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26781136-26781142(+) 26780979-26781110(-) 26781059-26781130(-) |
| Potential amino acid sequence |
MEGRFFPSLSGHLLAESRCATPFSASSKNNLARRICPFMNFLHLSVTFPLNMSSSVRPASANSS NGR*(+) MAAQGGEESTFHWMNWQRQV*(-) MKGQILRARLFFDEAEKGVAHLDSASRWPLKEGKNLPSIG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |