Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d040202_circ_g.3 |
ID in PlantcircBase | zma_circ_000193 |
Alias | NA |
Organism | Zea mays |
Position | chr3: 31837654-31837806 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Zm00001d040202 |
Parent gene annotation |
SNF7 family protein |
Parent gene strand | + |
Alternative splicing | Zm00001d040202_circ_g.2 |
Support reads | 16 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d040202_T007:1 Zm00001d040202_T003:1 Zm00001d040202_T006:1 Zm00001d040202_T004:1 Zm00001d040202_T005:1 Zm00001d040202_T009:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.541642958 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31837665-31837803(+) 31837712-31837791(-) |
Potential amino acid sequence |
MEACDLLGGDACNGPMFPEAKPASAAAAASRSVVGVDRDYLSYDEPKTVFPMEACDLLGGDACN GPMFPEAKPASAAAAASRSVVGVDRDYLSYDEPKTVFPMEACDLLGGDACNGPMFPEAKPASAA AAASRSVVGVDRDYLSYDEPKTVFPMEACDLLGGDACNGPMFPEAKPASAAAAASRSVVGVDRD YLSYDEPK(+) MGPLHASPPSRSQASIGNTVFGSS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |