Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G21470_circ_g.1 |
ID in PlantcircBase | ath_circ_014230 |
Alias | At_ciR4521 |
Organism | Arabidpsis thaliana |
Position | chr2: 9198871-9199542 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT2G21470 |
Parent gene annotation |
SUMO-activating enzyme subunit 2 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G21470.3:2 AT2G21470.1:2 AT2G21470.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.133198375 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9198886-9199539(+) |
Potential amino acid sequence |
MVGAGGIGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRRSHVGQSKAKGAKVLMVGAGG IGCELLKTLALSGFEDIHIIDMDTIEVSNLNRQFLFRRSHVGQSKAKGAKVLMVGAGGIGCELL KTLALSGFEDIHIIDMDTIEVSNLNRQFLFRRSHVGQSKAKGAKVLMVGAGGIGCELLKTLALS GFEDIHIIDMDTIEVSNLNRQFLFRRSHVGQSKAK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |