Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0664500_circ_g.2 |
| ID in PlantcircBase | osa_circ_003128 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 27147611-27147673 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os01g0664500 |
| Parent gene annotation |
Lg106-like family protein. (Os01t0664500-01);Non-protein coding transcript. (Os01t0664500-02);Lg106-like family protein. (Os01t0 664500-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0664500-03:1 Os01t0664500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.111111111 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27147666-27147613(-) 27147623-27147613(-) |
| Potential amino acid sequence |
MWRPLGQYSTIFFLDGCFLSYMWRPLGQYSTIFFLDGCFLSYMWRPLGQYSTIFFLDGCFLSYM WRPLGQYSTIFFLDGCF(-) MAASLVICGVLLGSIPPYFFLMAASLVICGVLLGSIPPYFFLMAASLVICGVLLGSIPPYFFLM AA(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |