Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G153900_circ_g.5 |
| ID in PlantcircBase | gra_circ_000632 |
| Alias | Chr06:41265801|41265912 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 41265801-41265912 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G153900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.006G153900_circ_g.2 orai.006G153900_circ_g.3 orai.006G153900_circ_g.4 |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.006G153900.1:1 Gorai.006G153900.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.543309524 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
41265849-41265874(-) |
| Potential amino acid sequence |
MSWRRKSLLYVNKKKQKNLNETVKLLANSEEELKKCRYELEEKEFIICEQKKAEKLERNRQIAR QL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |