Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0485000_circ_g.2 |
| ID in PlantcircBase | osa_circ_011489 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 17927385-17927779 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0485000 |
| Parent gene annotation |
Similar to O-sialoglycoprotein endopeptidase. (Os12t0485000-01); Peptidase M22, glycoprotease domain containing protein. (Os12t04 85000-02) |
| Parent gene strand | - |
| Alternative splicing | Os12g0485000_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0485000-01:2 Os12t0485000-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.322927511 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17927662-17927712(-) |
| Potential amino acid sequence |
MRKGGGPALEQLALEGDPNAVKFSVPMRQHKDCNFSYAGLKTQVRLAIESRNMRTQSSCSCSWT WSICSTGNYNR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |