Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0577500_circ_g.1 |
| ID in PlantcircBase | osa_circ_020530 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 21119642-21120150 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0577500 |
| Parent gene annotation |
Similar to Avr9 elicitor response-like protein. (Os03t0577500-01 );Similar to predicted protein. (Os03t0577500-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0577500-01:2 Os03t0577500-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.170602489 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21119702-21119644(+) 21120086-21120098(-) |
| Potential amino acid sequence |
MLSQYVTKSCYIYMYIIIHFNVVLCIPHGQGCHKERFRLCSQFQIPFNMIF*(+) MWDAEYYIKVDDDVHVNIATLGNILAKHRSKPRAYIGCMKSGPVLAQKIMLKGIWNWLQRRNRS L*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |