Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0771350_circ_g.10 |
ID in PlantcircBase | osa_circ_004093 |
Alias | Os_ciR6156 |
Organism | Oryza sativa |
Position | chr1: 32568170-32569349 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0771400 |
Parent gene annotation |
Similar to CM0545.290.nc protein. (Os01t0771400-00) |
Parent gene strand | - |
Alternative splicing | Os01g0771350_circ_g.11 Os01g0771350_circ_g.12 |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0771350-01:3 Os01t0771400-00:3 Os01t0771350-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010773 |
PMCS | 0.124474421 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32569324-32569329(-) |
Potential amino acid sequence |
MLVPDQDVVVEGPQPMEDSGSTVENEQVPETSTSRFTWTIEDFSNHRKLYSDVFVVGGHKWRVL VFPTGNSVQSLSMYLDIADANEQPHGWSKYAQFSLAVINQLDSKYSLRKAPAAGPG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |