Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0771350_circ_g.10 |
| ID in PlantcircBase | osa_circ_004093 |
| Alias | Os_ciR6156 |
| Organism | Oryza sativa |
| Position | chr1: 32568170-32569349 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0771400 |
| Parent gene annotation |
Similar to CM0545.290.nc protein. (Os01t0771400-00) |
| Parent gene strand | - |
| Alternative splicing | Os01g0771350_circ_g.11 Os01g0771350_circ_g.12 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0771350-01:3 Os01t0771400-00:3 Os01t0771350-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010773 |
| PMCS | 0.124474421 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32569324-32569329(-) |
| Potential amino acid sequence |
MLVPDQDVVVEGPQPMEDSGSTVENEQVPETSTSRFTWTIEDFSNHRKLYSDVFVVGGHKWRVL VFPTGNSVQSLSMYLDIADANEQPHGWSKYAQFSLAVINQLDSKYSLRKAPAAGPG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |