Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0651100_circ_g.1 |
| ID in PlantcircBase | osa_circ_020832 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 25280372-25284959 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0651100 |
| Parent gene annotation |
Peptidase S54, rhomboid domain containing protein. (Os03t0651100 -01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0651100_circ_g.2 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0651100-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104205743 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25284914-25280564(+) 25284943-25280581(+) 25280414-25284874(-) 25280388-25284833(-) |
| Potential amino acid sequence |
MKQRTMKYNRCIEPVHFSKPIPTSFLSSSSNVSTWSAATVASALTVFAAGCLL*(+) MYRTCTLFKAHSNQLLKFFIKCINLVSCYSCISSDCVCCWMPIVMENQK*(+) MKNLRSWLEWALKSVQVLYICCISWFFASCAIQHAGLGTLGH*(-) MGFEKCTGSIHLLYFMVLCFMCYSTCWPWYPWALSWKELWDQSVSCS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |