Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0497200_circ_g.6 |
| ID in PlantcircBase | osa_circ_024410 |
| Alias | Os_ciR1731 |
| Organism | Oryza sativa |
| Position | chr4: 24866132-24866439 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0497200 |
| Parent gene annotation |
Putative membrane-bound endo-1,4-beta-glucanase, Synthesis of ro ot cellulose, Modulation of root cell division and elongation (O s04t0497200-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 10/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0497200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.440088663 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24866307-24866138(+) 24866413-24866169(+) 24866289-24866370(-) |
| Potential amino acid sequence |
MELDVVAGVVVAADEPALDVRQIGAIRQAGVAAPFDAVVLREPAGWL*(+) MPLFFGSRPAGYRLCQWWKQRS*(+) MTMLSWSVIEYSAKYKAVGEYDHVRELIKWGTDYLLLTFNSSASTIDKVYSQPAGSRRTTASNG AATPACRMAPI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |