Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.008G116200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000842 |
| Alias | Chr08:34891703|34892231 |
| Organism | Gossypium raimondii |
| Position | chrChr08: 34891703-34892231 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.008G116200 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 10 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.008G116200.6:3 Gorai.008G116200.4:3 Gorai.008G116200.3:3 Gorai.008G116200.5:3 Gorai.008G116200.1:3 Gorai.008G116200.7:3 Gorai.008G116200.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.534972936 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34892187-34892202(-) 34891838-34891770(+) 34892185-34891757(+) |
| Potential amino acid sequence |
MAKVFSDLERSACRMLHNQVATIAWFEADSICGSHSVAIPLVLVIPYIWRLMQCLRQYKDTKEK TTLFNANFISRLLLG*(-) MQLSQPGYEASYRLNAPNLKIPWPWKLEYQPRRSREMKLALKRVVFSFVSLYCRRHCISRQI*( +) MEVRISAKKKSGNEIGVEKGCLFFCVFILPQTLH*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |