Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0526300_circ_g.1 |
| ID in PlantcircBase | osa_circ_037773 |
| Alias | Os_ciR1462 |
| Organism | Oryza sativa |
| Position | chr8: 26178808-26179346 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os08g0526300 |
| Parent gene annotation |
Similar to cDNA clone:001-038-D09, full insert sequence. (Os08t0 526300-01);tRNA-binding arm domain containing protein. (Os08t052 6300-02);tRNA-binding arm domain containing protein. (Os08t05263 00-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 11/5 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0526300-01:2 Os08t0526300-02:2 Os08t0526300-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007874* osi_circ_018092 |
| PMCS | 0.358428865 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26179326-26178867(+) 26178841-26178867(+) 26178843-26178867(-) 26178839-26178905(-) |
| Potential amino acid sequence |
MQSSKSKGPDEQRLLEASMAYVAGNPIMTDAEFDELKLRLRKEGSEIVQEGPRCSLRSRKALMS KDFWKHPWLMWLATPL*(+) MAYVAGNPIMTDAEFDELKLRLRKEGSEIVQEGPRCSLRSRKALMSKDFWKHPWLMWLATPL*( +) MDASKSLCSSGPFDFEDCILDLLVRFHFPLSLISALVHQIQHLS*(-) MLPKVFAHQGLSTSKTASWTFLYDFTSLFP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |