Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0526300_circ_g.1 |
ID in PlantcircBase | osa_circ_037773 |
Alias | Os_ciR1462 |
Organism | Oryza sativa |
Position | chr8: 26178808-26179346 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os08g0526300 |
Parent gene annotation |
Similar to cDNA clone:001-038-D09, full insert sequence. (Os08t0 526300-01);tRNA-binding arm domain containing protein. (Os08t052 6300-02);tRNA-binding arm domain containing protein. (Os08t05263 00-03) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 11/5 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0526300-01:2 Os08t0526300-02:2 Os08t0526300-03:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007874* osi_circ_018092 |
PMCS | 0.358428865 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26179326-26178867(+) 26178841-26178867(+) 26178843-26178867(-) 26178839-26178905(-) |
Potential amino acid sequence |
MQSSKSKGPDEQRLLEASMAYVAGNPIMTDAEFDELKLRLRKEGSEIVQEGPRCSLRSRKALMS KDFWKHPWLMWLATPL*(+) MAYVAGNPIMTDAEFDELKLRLRKEGSEIVQEGPRCSLRSRKALMSKDFWKHPWLMWLATPL*( +) MDASKSLCSSGPFDFEDCILDLLVRFHFPLSLISALVHQIQHLS*(-) MLPKVFAHQGLSTSKTASWTFLYDFTSLFP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |