Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0645200_circ_g.1 |
| ID in PlantcircBase | osa_circ_035003 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 26903286-26903490 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os07g0645200 |
| Parent gene annotation |
Similar to FAT domain-containing protein. (Os07t0645200-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0645200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.257553293 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26903454-26903337(+) 26903310-26903318(+) 26903462-26903289(-) 26903490-26903487(-) |
| Potential amino acid sequence |
MSMGYAPDYCLHSSSSRSPLNGCTDKFDDC*(+) MVVLINLMIVDFVAVGVANEHGLCSRLLSSFLILPQSPEWLY*(+) MLIGHAHSNKVNNHQIYQYNHSGDCGRMRNEDNNLEHNPCSLATPTATKSTIIKFISTTIQGTA GG*(-) MKTIIWSITHAHWPRPQQQSQQSSNLSVQPFRGLREDEE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |