Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d038922_circ_g.1 |
ID in PlantcircBase | zma_circ_009169 |
Alias | zma_circ_0002420 |
Organism | Zea mays |
Position | chr6: 166978652-166978944 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d038922 |
Parent gene annotation |
CRS1/YhbY (CRM) domain-containing protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d038922_T004:1 Zm00001d038922_T002:1 Zm00001d038922_T003:1 Zm00001d038922_T001:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.602596611 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
166978899-166978736(+) 166978911-166978920(-) |
Potential amino acid sequence |
MQVHIFNYTIKNTTNSSWRCIATARFNALAFVKRFLGLMLIGLL*(+) MHLHWKHREVVKLISKQKTLSFVEETARLLAYESGGILVAIERVPKGYALIFYRGKNYRRPINI RPRNLLTKAKALKRAVAMQRHEEFVVFLMV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |