Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0582100_circ_g.4 |
| ID in PlantcircBase | osa_circ_029099 |
| Alias | Os_ciR10151 |
| Organism | Oryza sativa |
| Position | chr5: 28964146-28964569 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0582100 |
| Parent gene annotation |
Cas1p-like family protein. (Os05t0582100-01);Similar to predicte d protein. (Os05t0582100-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0582100_circ_g.5 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0582100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.199003872 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28964540-28964557(-) |
| Potential amino acid sequence |
MKEDDKAVLLEGGQSKSPSTKLRNMSTKANLIRFITMDESFLLENRAVLRAMAEVGIILVYFYI CDRTNIFPETKKSLGC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |