Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0102200_circ_g.2 |
| ID in PlantcircBase | osa_circ_008218 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 86977-87190 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os11g0102200 |
| Parent gene annotation |
Similar to NPH1-1. (Os11t0102200-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 8 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0102200-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003268* |
| PMCS | 0.639981887 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
86988-87024(+) 87191-87161(-) |
| Potential amino acid sequence |
MGHGSVEKNMLKPRDEDPLIDSDDERPESFEDEFRRKEMRRGIDLATTLERIEKNFVITDPRLP DNPIFSWYGPWKCREEHAET*(+) MGLSGNLGSVMTKFFSIRSSVVAKSIPLLISFLLNSSSKLSGLSSSLSISGSSSLGFSMFFSTL PWPIPRKNGIIRQPWICDDKILLNTFKCSSQVYTPPHFFPPKLIFKALRSFIITIDQWIFISRF QHVLLYTSMAHTKKKWDYQATLDL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |