Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0700600_circ_g.1 |
| ID in PlantcircBase | osa_circ_016104 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 28822250-28822652 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0700600 |
| Parent gene annotation |
Similar to GAMYB-binding protein. (Os02t0700600-01);Similar to C yclin-dependent kinase F-4. (Os02t0700600-02);Similar to cDNA cl one:J013158B11, full insert sequence. (Os02t0700600-03);Similar to Cyclin-dependent kinase F-4. (Os02t0700600-04);Non-protein co ding transcript. (Os02t0700600-05) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0700600-01:2 Os02t0700600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.183610897 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28822324-28822506(-) 28822299-28822598(-) |
| Potential amino acid sequence |
MCPEDHFFHVSDQNFKLPKSQLVQSSLYDQHLQLKGSFFRDDVM*(-) MSLIKTLSSPNHSWSNPAYMISIYNLKEASLEMT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |