Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0276800_circ_g.3 |
ID in PlantcircBase | osa_circ_001314 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 9707451-9709041 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0276800 |
Parent gene annotation |
Mannose-6-phosphate receptor, binding domain containing protein. (Os01t0276800-01);Similar to predicted protein. (Os01t0276800-0 2);Hypothetical conserved gene. (Os01t0276800-03);Similar to pre dicted protein. (Os01t0276800-04);Similar to predicted protein. (Os01t0276800-05) |
Parent gene strand | - |
Alternative splicing | Os01g0276800_circ_g.1 Os01g0276800_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0276800-03:3 Os01t0276800-01:4 Os01t0276800-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.128487272 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9708993-9707481(+) 9707514-9708959(-) 9708328-9708963(-) |
Potential amino acid sequence |
MPSILAVELPLRARRCPCSTDDSLSGV*(+) MMDMPRAMTITHQKASHLLSRDIGVPGGEVLLPECWAFSHHDLLVASE*(-) MKEEAEKQAADEKKASDASQEVDSQENHETVQEDESKVAEHHDGHATSHDNHTPESESSVEQGH RRARRGSSTARMLGILPSRSSRRE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |