Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0276800_circ_g.3 |
| ID in PlantcircBase | osa_circ_001314 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 9707451-9709041 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0276800 |
| Parent gene annotation |
Mannose-6-phosphate receptor, binding domain containing protein. (Os01t0276800-01);Similar to predicted protein. (Os01t0276800-0 2);Hypothetical conserved gene. (Os01t0276800-03);Similar to pre dicted protein. (Os01t0276800-04);Similar to predicted protein. (Os01t0276800-05) |
| Parent gene strand | - |
| Alternative splicing | Os01g0276800_circ_g.1 Os01g0276800_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0276800-03:3 Os01t0276800-01:4 Os01t0276800-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.128487272 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9708993-9707481(+) 9707514-9708959(-) 9708328-9708963(-) |
| Potential amino acid sequence |
MPSILAVELPLRARRCPCSTDDSLSGV*(+) MMDMPRAMTITHQKASHLLSRDIGVPGGEVLLPECWAFSHHDLLVASE*(-) MKEEAEKQAADEKKASDASQEVDSQENHETVQEDESKVAEHHDGHATSHDNHTPESESSVEQGH RRARRGSSTARMLGILPSRSSRRE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |